CookSnap is coming soon — Join the waitlist →

20-Min Nasi Kandar Bowl

Malaysian street-food rice bowl with spiced curry oil, tender chicken and shrimp, and a bright squeeze of lime. Built on pre-cooked rice and finished in one skillet in under 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
28g
20-Min Nasi Kandar Bowl
quicksatisfyingmalaysianchickenshrimptenderjuicyweeknight

Ingredients

  • 3 tbsp neutral oil
  • 2 tsp curry powder
  • ½ tsp turmeric
  • 6 oz chicken breast, thinly sliced
  • 5 oz shrimp, peeled and deveined
  • 2 cups cooked jasmine rice (day-old or warm)
  • 1 whole lime
  • 2 tbsp fresh cilantro or green onion, chopped

Instructions

  1. 1

    Heat oil in a large skillet over medium-high heat, ~90 seconds. Add curry powder and turmeric; cook 30 seconds until fragrant.

  2. 2

    Add chicken slices and cook, stirring, until no pink remains, ~4 minutes. Push to the side of the skillet.

  3. 3

    Add shrimp to the empty side; cook without stirring until opaque pink, ~2 minutes per side. Toss everything together.

  4. 4

    Fold in the rice, breaking up any clumps, until warmed through and coated with curry oil, ~2 minutes.

  5. 5

    Squeeze half the lime over the bowl. Divide between bowls and top with cilantro.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon or spatula
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.