5-Minute Milk Tea with Boba
Chilled Taiwanese milk tea loaded with chewy tapioca pearls—ready in minutes using brewed tea, sweetened condensed milk, and ice. No stove required.
- Total time
- 5 min
- Servings
- 2
- Calories
- 280
- Protein
- 4g
refreshingcasualtaiwanesevegetariancreamychewyweeknightsummer
Ingredients
- 1.5 cups strong brewed black or oolong tea, cooled
- ½ cup sweetened condensed milk
- ½ cup cooked tapioca pearls (boba)
- 1 cup ice cubes
- ¼ cup whole milk or heavy cream
Instructions
- 1
Divide ice and cooked tapioca pearls between two tall glasses, about 1/4 cup pearls per glass.
- 2
Pour cooled tea evenly into both glasses, filling them about halfway.
- 3
Add 1/4 cup sweetened condensed milk to each glass, stirring to combine.
- 4
Top each glass with 2 tablespoons whole milk or cream for a signature marbled swirl.
- 5
Insert a wide straw, stir once, and serve immediately.
Tools you’ll need
- two tall glasses
- wide bubble tea straw
- spoon for stirring
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
