CookSnap is coming soon — Join the waitlist →
Back to recipes

5-Minute Milk Tea with Boba

Chilled Taiwanese milk tea loaded with chewy tapioca pearls—ready in minutes using brewed tea, sweetened condensed milk, and ice. No stove required.

Total time
5 min
Servings
2
Calories
280
Protein
4g
5-Minute Milk Tea with Boba
refreshingcasualtaiwanesevegetariancreamychewyweeknightsummer

Ingredients

  • 1.5 cups strong brewed black or oolong tea, cooled
  • ½ cup sweetened condensed milk
  • ½ cup cooked tapioca pearls (boba)
  • 1 cup ice cubes
  • ¼ cup whole milk or heavy cream

Instructions

  1. 1

    Divide ice and cooked tapioca pearls between two tall glasses, about 1/4 cup pearls per glass.

  2. 2

    Pour cooled tea evenly into both glasses, filling them about halfway.

  3. 3

    Add 1/4 cup sweetened condensed milk to each glass, stirring to combine.

  4. 4

    Top each glass with 2 tablespoons whole milk or cream for a signature marbled swirl.

  5. 5

    Insert a wide straw, stir once, and serve immediately.

Tools you’ll need

  • two tall glasses
  • wide bubble tea straw
  • spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.