Custrd is out on the App Store — Download it free →
Back to recipes

5-Minute Milk Tea with Boba

Chilled Taiwanese milk tea loaded with chewy tapioca pearls—ready in minutes using brewed tea, sweetened condensed milk, and ice. No stove required.

Total time
5 min
Servings
2
Calories
280
Protein
4g
5-Minute Milk Tea with Boba
refreshingcasualtaiwanesevegetariancreamychewyweeknightsummer

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Divide ice and cooked tapioca pearls between two tall glasses, about 1/4 cup pearls per glass.

  2. Step 2

    Pour cooled tea evenly into both glasses, filling them about halfway.

  3. Step 3

    Add 1/4 cup sweetened condensed milk to each glass, stirring to combine.

  4. Step 4

    Top each glass with 2 tablespoons whole milk or cream for a signature marbled swirl.

  5. Step 5

    Insert a wide straw, stir once, and serve immediately.

Tools you’ll need

  • two tall glasses
  • wide bubble tea straw
  • spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.