CookSnap is coming soon — Join the waitlist →

Lemon Ricotta Pasta

Creamy ricotta coats tender pasta with bright lemon, garlic, and fresh herbs in under 20 minutes. A light, elegant weeknight dinner that feels restaurant-quality.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Lemon Ricotta Pasta
lightelegantitalianvegetariancheesecreamytenderweeknight

Ingredients

  • 8 oz fettuccine or linguine
  • 1 cup whole-milk ricotta
  • 1 whole (zested + juiced) lemon
  • 2 whole garlic clove, minced
  • 3 tbsp olive oil
  • ¼ cup fresh parsley or basil, chopped
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add pasta and cook until al dente, ~9 minutes.

  2. 2

    While pasta cooks, whisk ricotta with lemon zest, lemon juice, and salt in a bowl until smooth.

  3. 3

    Heat olive oil in a large skillet over medium. Add garlic and cook 30 seconds until fragrant.

  4. 4

    Reserve 1 cup pasta water, then drain pasta and add it to the skillet with garlic and oil.

  5. 5

    Remove skillet from heat. Stir in ricotta mixture, adding pasta water 1/4 cup at a time until creamy.

  6. 6

    Taste and adjust salt and pepper. Top with fresh herbs and serve immediately.

Tools you’ll need

  • large pot
  • large skillet
  • whisk
  • bowl
  • tongs or pasta fork
  • microplane or box grater (for lemon zest)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.