Lemon Pepper Salmon
Buttery salmon fillets seasoned with lemon pepper and air-fried until flaky in under 15 minutes. A weeknight dinner that tastes restaurant-quality with zero fuss.
- Total time
- 15 min
- Servings
- 2
- Calories
- 245
- Protein
- 28g
simplefreshamericansalmontenderflakyweeknightmain-dish
Ingredients
- 2 fillets (5 oz each) salmon fillet
- 1 tsp lemon pepper seasoning
- 1 tbsp butter
Instructions
- 1
Pat salmon dry and place skin-side down on the air fryer tray.
- 2
Divide butter between fillets and dot the tops evenly.
- 3
Sprinkle lemon pepper seasoning generously over each fillet.
- 4
Air fry at 380°F for 12 minutes until the surface looks opaque and flakes easily.
- 5
Serve hot.
Tools you’ll need
- air fryer
- air fryer tray
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
