Lazy Lasagna
No-boil lasagna noodles layered with marinara, ricotta, and mozzarella, then baked until bubbly. Ready in under 20 minutes with zero fuss.
- Total time
- 18 min
- Servings
- 4
- Calories
- 385
- Protein
- 18g
comfortsimpleitalianvegetariancreamymeltyweeknightpasta
Ingredients
- 9 sheets lasagna noodles (no-boil)
- 1.5 cups marinara sauce
- 1 cup ricotta cheese
- 1.5 cups mozzarella cheese, shredded
Instructions
- 1
Preheat oven to 375°F.
- 2
Spread a thin layer of marinara on the bottom of an 8x8-inch baking dish.
- 3
Layer 3 noodles over sauce, then 1/3 ricotta, 1/3 mozzarella, and 1/3 remaining marinara.
- 4
Repeat layers twice more, ending with mozzarella on top.
- 5
Bake uncovered until bubbling at edges and cheese is golden, 12–14 minutes.
- 6
Let rest 2 minutes, then serve.
Tools you’ll need
- 8x8-inch baking dish
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
