CookSnap is coming soon — Join the waitlist →
Back to recipes

Korean Fish Cake Stir-Fry

Chewy fish cakes and crisp vegetables in a savory-sweet gochujang glaze, ready in under 20 minutes. A quick weeknight dinner that tastes like restaurant takeout.

Total time
18 min
Servings
2
Calories
210
Protein
14g
Korean Fish Cake Stir-Fry
quickcasualkoreanfishchewycrispytenderweeknight

Ingredients

  • 8 oz fish cakes (eomuk), halved lengthwise
  • 2 tbsp gochujang (Korean red pepper paste)
  • 1 tbsp soy sauce
  • 1 tsp sugar
  • 1 medium bell pepper (red or yellow), cut into 1-inch squares
  • 2 tbsp vegetable oil

Instructions

  1. 1

    Stir gochujang, soy sauce, and sugar together in a small bowl until smooth.

  2. 2

    Heat oil in a large skillet over medium-high heat until it shimmers, about 90 seconds.

  3. 3

    Add fish cakes and bell pepper. Stir-fry until fish cakes are lightly golden and vegetables soften, 5–6 minutes.

  4. 4

    Pour gochujang sauce over. Toss until coated and the sauce is glossy, about 1 minute.

  5. 5

    Serve hot directly from the skillet or divide between bowls.

Tools you’ll need

  • large skillet (10–12 inch)
  • small mixing bowl
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.