Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Spiced Fish — Ikan Woku

Whole fish crisped in a skillet, then tossed with a fragrant aromatics and spice paste that clings to every golden edge. Manado-style, ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
42g
Crispy Spiced Fish — Ikan Woku
boldfreshindonesianfishcrispytenderweeknightdinner

Ingredients

  • 1 fish (1.5–2 lbs) whole white fish (snapper, grouper, or sea bass), cleaned and gutted
  • 3 medium shallots, thinly sliced
  • 4 cloves garlic cloves, minced
  • 2 medium fresh red chili, minced (or 1 tsp chili flakes)
  • 1 tsp turmeric powder
  • 1 whole lime
  • 3 tbsp neutral cooking oil

Instructions

  1. 1

    Pat the fish dry inside and out with paper towels. Score the sides diagonally 3–4 times to help it crisp.

  2. 2

    Season the fish generously with salt and pepper, inside the cavity and on both sides.

  3. 3

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  4. 4

    Lay the fish in the skillet and sear without moving for 5–6 minutes until the skin is golden and crispy.

  5. 5

    Flip the fish carefully and cook the other side another 4–5 minutes until the flesh flakes easily at the thickest part.

  6. 6

    Push the fish to the side of the skillet. Add shallots, garlic, chili, and turmeric to the empty space; stir constantly for 60 seconds until fragrant.

  7. 7

    Toss the aromatics over the fish until coated, breaking up any clumps. Squeeze lime over the top and serve immediately.

Tools you’ll need

  • large skillet (12–14 inches)
  • paper towels
  • knife and cutting board
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.