Custrd is out on the App Store — Download it free →
Back to recipes

Homemade Mochi with Kinako & Red Bean

Pillowy mochi made from scratch in 20 minutes, dusted with nutty kinako powder and filled with sweet red bean paste. A stunning TikTok-worthy Japanese rice cake that tastes like a dessert but comes together faster than you'd think.

Total time
20 min
Servings
4
Calories
185
Protein
3g
Homemade Mochi with Kinako & Red Bean
elegantindulgentjapanesevegetariandairy-freechewyfluffysoft

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix sweet rice flour, sugar, and salt in a microwave-safe bowl. Whisk in water until completely smooth.

  2. Step 2

    Cover bowl loosely with plastic wrap. Microwave on high for 2 minutes, stir, then microwave another 1-2 minutes until the dough is translucent and glossy.

  3. Step 3

    Dust a work surface generously with potato starch. Pour hot mochi dough onto the starch and let cool for 1 minute until you can handle it.

  4. Step 4

    Divide mochi into 8 equal pieces. Flatten each piece, spoon 1.5 teaspoons of red bean paste into the center, then fold edges up and seal gently.

  5. Step 5

    Roll each filled mochi ball lightly in potato starch to coat all sides, shaking off excess.

  6. Step 6

    Arrange mochi on a serving plate and dust generously with kinako powder just before serving.

Tools you’ll need

  • microwave-safe bowl
  • whisk
  • plastic wrap
  • microwave
  • work surface or cutting board
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.