CookSnap is coming soon — Join the waitlist →

Homemade Mochi with Kinako & Red Bean

Pillowy mochi made from scratch in 20 minutes, dusted with nutty kinako powder and filled with sweet red bean paste. A stunning TikTok-worthy Japanese rice cake that tastes like a dessert but comes together faster than you'd think.

Total time
20 min
Servings
4
Calories
185
Protein
3g
Homemade Mochi with Kinako & Red Bean
elegantindulgentjapanesevegetariandairy-freechewyfluffysoft

Ingredients

  • 1 cup sweet rice flour (mochiko)
  • ¼ cup granulated sugar
  • ¾ cup water
  • ¾ cup red bean paste (adzuki or sweet red bean)
  • ¼ cup kinako powder (roasted soybean powder)
  • ¼ cup potato starch or cornstarch
  • 1 tbsp neutral oil (for hands)
  • ⅛ tsp salt

Instructions

  1. 1

    Mix sweet rice flour, sugar, and salt in a microwave-safe bowl. Whisk in water until completely smooth.

  2. 2

    Cover bowl loosely with plastic wrap. Microwave on high for 2 minutes, stir, then microwave another 1-2 minutes until the dough is translucent and glossy.

  3. 3

    Dust a work surface generously with potato starch. Pour hot mochi dough onto the starch and let cool for 1 minute until you can handle it.

  4. 4

    Divide mochi into 8 equal pieces. Flatten each piece, spoon 1.5 teaspoons of red bean paste into the center, then fold edges up and seal gently.

  5. 5

    Roll each filled mochi ball lightly in potato starch to coat all sides, shaking off excess.

  6. 6

    Arrange mochi on a serving plate and dust generously with kinako powder just before serving.

Tools you’ll need

  • microwave-safe bowl
  • whisk
  • plastic wrap
  • microwave
  • work surface or cutting board
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.