Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Eel Rice Bowl

A quick and satisfying bowl of rice topped with savory grilled eel, pickled ginger, and crisp vegetables. Perfect for a weeknight dinner that feels special.

Total time
15 min
Servings
2
Calories
550
Protein
25g
Grilled Eel Rice Bowl
comfortingJapanesepescatarianfishtendercrispweeknightmain course

Ingredients

  • 2 cups cooked sushi rice
  • 8 oz grilled eel (unagi)
  • 2 tbsp pickled ginger
  • 1 cup shredded daikon radish
  • 2 oz kamaboko (fish cake)
  • 4 leaves shiso leaves
  • 1 tbsp soy sauce
  • 1 tbsp mirin

Instructions

  1. 1

    In a small bowl, mix the 1 tbsp soy sauce and 1 tbsp mirin. Brush this glaze over the 8 oz grilled eel.

  2. 2

    Place the eel on a baking sheet and broil for 3-4 minutes until the glaze bubbles and the edges are slightly charred.

  3. 3

    Divide the 2 cups cooked sushi rice between two bowls.

  4. 4

    Slice the broiled eel into 1-inch pieces and arrange over the rice.

  5. 5

    Top each bowl with 1 tbsp pickled ginger, 1/2 cup shredded daikon, and 1 oz sliced kamaboko.

  6. 6

    Tear the 4 shiso leaves and scatter over the bowls. Serve immediately.

  7. 7

    Optional: add a sprinkle of sesame seeds or a drizzle of extra soy sauce if you like.

Tools you’ll need

  • small bowl
  • baking sheet
  • broiler
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.