CookSnap is coming soon — Join the waitlist →

Grilled Denis Fish with Lemon, Rice & Farofa

Whole sea bream grilled until crispy-skinned and flaky, served over fluffy rice with toasted farofa and bright lemon-herb oil. Restaurant-style Israeli grilled fish that tastes like the coast.

Total time
25 min
Servings
2
Calories
680
Protein
48g
Grilled Denis Fish with Lemon, Rice & Farofa
elegantlightisraelimediterraneanfishcrispyflakytender

Ingredients

  • 2 fish (about 1 lb total) whole sea bream (or branzino), cleaned and gutted
  • 1.5 whole (zested and juiced) lemon
  • ½ cup (or fresh herbs to taste) fresh parsley and dill, chopped
  • 1 cup white rice, uncooked
  • ½ cup farofa (toasted cassava flour)
  • 1 whole lime
  • 1 medium tomato
  • 4 tbsp olive oil

Instructions

  1. 1

    Start rice in a pot with 2 cups salted water; bring to boil, then reduce heat to low, cover, and cook until tender, ~18 minutes.

  2. 2

    Pat fish dry inside and out. Score skin diagonally 2–3 times. Season generously with salt and pepper inside the cavity and all over.

  3. 3

    Heat a grill or grill pan over medium-high until very hot. Lightly oil the grates, then place fish on grill.

  4. 4

    Grill 6–7 minutes per side without moving until skin is golden and crispy and flesh flakes easily at the thickest part.

  5. 5

    Whisk together olive oil, lemon zest, lemon juice, and fresh herbs. Drizzle over finished fish.

  6. 6

    Serve fish over rice alongside farofa, lime wedges, and tomato slices. Finish with extra herb oil and flake of salt.

Tools you’ll need

  • pot with lid
  • grill or grill pan
  • small bowl for herb oil
  • whisk
  • cutting board
  • chef's knife
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.