Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Denis Fish with Lemon, Rice & Farofa

Whole sea bream grilled until crispy-skinned and flaky, served over fluffy rice with toasted farofa and bright lemon-herb oil. Restaurant-style Israeli grilled fish that tastes like the coast.

Total time
25 min
Servings
2
Calories
680
Protein
48g
Grilled Denis Fish with Lemon, Rice & Farofa
elegantlightisraelimediterraneanfishcrispyflakytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Start rice in a pot with 2 cups salted water; bring to boil, then reduce heat to low, cover, and cook until tender, ~18 minutes.

  2. Step 2

    Pat fish dry inside and out. Score skin diagonally 2–3 times. Season generously with salt and pepper inside the cavity and all over.

  3. Step 3

    Heat a grill or grill pan over medium-high until very hot. Lightly oil the grates, then place fish on grill.

  4. Step 4

    Grill 6–7 minutes per side without moving until skin is golden and crispy and flesh flakes easily at the thickest part.

  5. Step 5

    Whisk together olive oil, lemon zest, lemon juice, and fresh herbs. Drizzle over finished fish.

  6. Step 6

    Serve fish over rice alongside farofa, lime wedges, and tomato slices. Finish with extra herb oil and flake of salt.

Tools you’ll need

  • pot with lid
  • grill or grill pan
  • small bowl for herb oil
  • whisk
  • cutting board
  • chef's knife
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.