Golden Waffles with Maple Syrup
Crispy-edged, fluffy waffles made from four staple ingredients and served with melted butter and warm maple syrup. Ready in under 20 minutes.
- Total time
- 18 min
- Servings
- 2
- Calories
- 380
- Protein
- 7g
comfortcozyamericanvegetarianeggscrispyfluffyweeknight
Ingredients
- 1 cup flour
- ¾ cup milk
- 1 large egg
- 3 tbsp butter, melted
Instructions
- 1
Whisk flour, milk, egg, melted butter, salt, and pepper in a bowl until no lumps remain.
- 2
Heat waffle iron until water droplets sizzle and evaporate on contact, ~3 minutes.
- 3
Pour batter into the iron, close lid, and cook until golden brown and steam stops, ~4 minutes.
- 4
Slide waffle onto a plate and repeat with remaining batter.
- 5
Top with butter and warm maple syrup, then serve immediately.
Tools you’ll need
- waffle iron
- large mixing bowl
- whisk
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
