CookSnap is coming soon — Join the waitlist →

Classic French Toast

Thick slices of bread soaked in a custardy egg-milk mixture, then pan-fried until golden and crispy. Serve warm with butter, maple syrup, or fresh berries for a comforting breakfast.

Total time
20 min
Servings
2
Calories
385
Protein
11g
Classic French Toast
comfortcozyamericanvegetarianeggscrispyfluffysoft

Ingredients

  • 2 large eggs
  • ⅓ cup whole milk
  • ½ teaspoon vanilla extract
  • ¼ teaspoon ground cinnamon
  • 4 slices bread (brioche or thick white bread slices)
  • 1 tablespoon butter
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Crack the 2 eggs into a wide, shallow bowl (such as a soup bowl or baking dish). Pour in 0.33 cup milk, 0.5 teaspoon vanilla extract, 0.25 teaspoon cinnamon, and a small pinch of salt and pepper.

  2. 2

    Whisk the egg mixture with a fork until the eggs are fully broken up and no white streaks remain, about 15 seconds. The mixture should look pale yellow and uniform.

  3. 3

    Place a 12-inch nonstick skillet or griddle on the stovetop and turn the heat to medium. Let it warm for 30 seconds, then add 1 tablespoon butter and let it melt and coat the pan evenly.

  4. 4

    Pick up one bread slice, dip one side into the egg mixture for 1 second (count 'one-one-thousand'), then flip it and dip the other side for 1 second. The bread should be wet but not dripping.

  5. 5

    Lay the coated bread slice on the hot buttered pan. Repeat with the remaining 3 slices, arranging them in the pan so they do not touch or overlap.

  6. 6

    Cook the French toast without moving it for 2 to 3 minutes, until the bottom is golden brown and feels firm when you press it gently with a spatula.

  7. 7

    Using a thin metal spatula, slide underneath one slice and flip it gently, supporting it from underneath so it does not break. Repeat for the other 3 slices.

  8. 8

    Cook the second side for 1 to 2 minutes, until it is also golden brown and the bread springs back slightly when poked.

  9. 9

    Transfer the hot French toast to a serving plate using the spatula. Serve immediately with butter, maple syrup, fresh berries, powdered sugar, or your favorite toppings.

Tools you’ll need

  • large shallow bowl or baking dish
  • fork
  • 12-inch nonstick skillet or griddle
  • thin metal spatula
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.