CookSnap is coming soon — Join the waitlist →
Back to recipes

Goan Fish Curry

Silky coconut curry with fresh white fish, aromatic spices, and bright citrus. One-pan dinner ready in 30 minutes.

Total time
30 min
Servings
4
Calories
285
Protein
34g
Goan Fish Curry
comfortfreshindianfishtendercreamyweeknightdinner

Ingredients

  • 1.5 lbs white fish fillets (cod, halibut, or sea bass)
  • 14 oz coconut milk
  • 1 medium onion, thinly sliced
  • 4 cloves garlic, minced
  • 1 tbsp ginger, minced
  • 2 tsp curry powder and cayenne, mixed (or goan masala)
  • 1 whole lime (juiced) plus salt and pepper to taste

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering, ~90 seconds.

  2. 2

    Add onion and cook, stirring often, until softened and translucent, ~4 minutes.

  3. 3

    Stir in garlic and ginger. Cook until fragrant, ~60 seconds.

  4. 4

    Add curry powder and cayenne. Stir constantly for 30 seconds to bloom the spices.

  5. 5

    Pour in coconut milk. Scrape up any browned bits from the pan bottom.

  6. 6

    Bring to a gentle simmer. Add fish, nestling fillets into the sauce.

  7. 7

    Cover and simmer until fish flakes easily with a fork, ~8 minutes.

  8. 8

    Squeeze lime juice over the curry. Taste and adjust salt and pepper.

  9. 9

    Serve in shallow bowls with rice or flatbread.

Tools you’ll need

  • large skillet with lid (12-inch preferred)
  • cutting board
  • chef's knife
  • wooden spoon
  • lime squeezer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.