CookSnap is coming soon — Join the waitlist →
Back to recipes

Garlicky Glazed Eggplant

Silky eggplant braised in a savory-sweet garlic sauce until tender and glossy. Ready in under 20 minutes, no fuss, pure TikTok magic.

Total time
18 min
Servings
2
Calories
145
Protein
2g
Garlicky Glazed Eggplant
comfortsimplechinesevegetarianvegansilkytenderweeknight

Ingredients

  • 1.25 lb Chinese eggplant (or Japanese eggplant), halved lengthwise
  • 6 whole garlic cloves, minced
  • 3 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 1 tsp granulated sugar
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Place eggplant cut-side down in the hot skillet and sear 4 minutes until the surface turns golden and begins to soften.

  3. 3

    Flip eggplant skin-side down. Add minced garlic to the pan and stir for 30 seconds until fragrant.

  4. 4

    Pour in soy sauce, vinegar, sugar, and 1/4 cup water. Bring to a simmer and braise for 6 minutes until eggplant is very tender.

  5. 5

    Tilt the skillet and spoon the glossy sauce over the eggplant. Transfer to a plate and pour all sauce on top.

Tools you’ll need

  • large skillet or sauté pan (12-inch)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Chinese recipes →