CookSnap is coming soon — Join the waitlist →
Back to recipes

Garlic Soy Braised Eggplant

Silky eggplant cooked until tender in a glossy garlic-soy sauce that clings to every piece. One skillet, 18 minutes, umami-packed and dangerously easy.

Total time
18 min
Servings
2
Calories
187
Protein
2g
Garlic Soy Braised Eggplant
comfortwholesomechinesevegetarianvegandairy-freevegetariansilky

Ingredients

  • 1.5 lb eggplant (Japanese or Chinese), cut into 2-inch chunks
  • 6 cloves garlic cloves, minced
  • 3 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 1 tsp sugar
  • 3 tbsp neutral cooking oil

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering, about 1 minute.

  2. 2

    Add eggplant chunks and stir occasionally until edges are golden, about 5 minutes.

  3. 3

    Push eggplant to the sides, add garlic to the center, and cook until fragrant, 30 seconds.

  4. 4

    Stir soy sauce, rice vinegar, and sugar into a splash of water, then pour into the skillet.

  5. 5

    Cover and simmer until eggplant is completely tender and sauce clings glossy, about 8 minutes.

  6. 6

    Serve hot, spooning the glossy sauce over each portion.

Tools you’ll need

  • large skillet or wok (12-inch)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Chinese recipes →