CookSnap is coming soon — Join the waitlist →

Garlic Fries San Francisco

Crispy oven-baked fries tossed with garlic, herbs, and a touch of vinegar for that iconic San Francisco flavor. Ready in under 25 minutes with minimal cleanup.

Total time
25 min
Servings
2
Calories
285
Protein
4g
Garlic Fries San Francisco
comfortsimplecalifornianvegetarianvegancrispytenderweeknight

Ingredients

  • 1.5 lbs russet potatoes
  • 3 tablespoons olive oil
  • 4 cloves garlic, minced
  • 2 tablespoons fresh parsley, chopped
  • 1 tablespoon red wine vinegar
  • 1 to taste salt and pepper

Instructions

  1. 1

    Set the oven to 425°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. 2

    Scrub the potatoes under cold running water with a vegetable brush to remove any dirt, then pat them dry with a clean kitchen towel.

  3. 3

    Place each potato on a cutting board and cut lengthwise into 1/4-inch-thick slabs, like slicing bread; then cut each slab lengthwise into 1/4-inch-thick fries, similar to the thickness of a pencil.

  4. 4

    Place the cut fries in a large bowl, drizzle with 3 tablespoons olive oil, sprinkle with salt and pepper, and toss with your hands until every piece is evenly coated.

  5. 5

    Spread the fries in a single layer on a sheet pan, leaving no overlaps so they roast instead of steam, then place the pan in the preheated oven.

  6. 6

    Roast for 15–18 minutes, stirring the fries once halfway through (at about 8 minutes), until the surface turns the color of warm honey and the edges are slightly darker.

  7. 7

    While the fries roast, mince the garlic until the pieces are smaller than a grain of rice—about the size of pencil-tip dots.

  8. 8

    Remove the sheet pan from the oven and immediately sprinkle the minced garlic over the hot fries, stirring quickly to distribute it evenly.

  9. 9

    Drizzle 1 tablespoon red wine vinegar over the fries and stir to coat.

  10. 10

    Scatter 2 tablespoons chopped parsley over the top and toss once more, then taste and adjust salt and pepper as needed.

Tools you’ll need

  • oven
  • sheet pan
  • large mixing bowl
  • vegetable brush
  • cutting board
  • sharp chef's knife
  • kitchen towel

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.