CookSnap is coming soon — Join the waitlist →

Fondue Moitié-Moitié

A classic Swiss cheese fondue combining Emmental and Gruyère for a silky, nutty dip. Serve with crusty bread cubes, potatoes, and vegetables for an interactive dinner.

Total time
20 min
Servings
4
Calories
420
Protein
24g
Fondue Moitié-Moitié
comfortindulgentswissvegetariancheesecreamysilkymelty

Ingredients

  • 8 oz Emmental cheese, coarsely grated
  • 8 oz Gruyère cheese, coarsely grated
  • ¾ cup dry white wine (Neuchâtel or Sauvignon Blanc)
  • 1.5 tbsp cornstarch
  • 1 whole garlic clove, halved
  • ¼ tsp black pepper
  • 1 serving crusty bread, potatoes, apple slices, and vegetables (carrots, mushrooms, cornichons) for dipping

Instructions

  1. 1

    Mix grated Emmental and Gruyère in a bowl. Toss with cornstarch until each piece is coated.

  2. 2

    Cut bread into 1-inch cubes. Boil potatoes until fork-tender; halve them. Arrange all dipping items on a platter.

  3. 3

    Rub the inside of a fondue pot or small heavy saucepan with the halved garlic; discard garlic.

  4. 4

    Pour wine into the pot and warm over medium heat until wisps of steam appear, ~3 minutes.

  5. 5

    Add cheese handful by handful, stirring constantly in a figure-8 pattern until melted and smooth, ~6 minutes.

  6. 6

    Season with black pepper. The fondue should coat the back of a spoon; if too thick, stir in 1–2 tbsp wine.

  7. 7

    Transfer to a fondue pot over a low flame, or keep in the saucepan on a trivet over a lit candle or burner.

  8. 8

    Serve immediately. Spear bread or vegetables, dip, swirl in the pot, and eat.

Tools you’ll need

  • fondue pot or small heavy-bottomed saucepan
  • fondue forks or long skewers
  • wooden spoon
  • grater
  • cutting board
  • kitchen knife
  • medium bowl
  • whisk or spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.