CookSnap is coming soon — Join the waitlist →

Flan con Dulce de Leche

A silky Argentine custard with a caramel-dulce de leche layer and crispy sugar shell. Rich, elegant, and absolutely worth the time.

Total time
75 min
Servings
6
Calories
412
Protein
7g
Flan con Dulce de Leche
elegantindulgentargentinianvegetariansilkycreamycrispydinner

Ingredients

  • 1 cup sugar
  • 3 tbsp water
  • 1.5 cups whole milk
  • ½ cup heavy cream
  • 1 tsp vanilla extract
  • ¼ tsp salt
  • 5 count large eggs
  • 1 count egg yolk
  • ½ cup sugar
  • ½ cup dulce de leche

Instructions

  1. 1

    Combine 1 cup sugar and 3 tbsp water in a saucepan over medium-high heat.

  2. 2

    Do not stir. Swirl the pan occasionally until the sugar dissolves and turns deep amber, ~8 minutes.

  3. 3

    Remove from heat. Immediately pour the caramel into a 9-inch round baking dish, coating the bottom evenly.

  4. 4

    Heat milk and cream in a saucepan over medium until steaming, ~4 minutes. Do not boil.

  5. 5

    In a bowl, whisk 5 eggs, 1 egg yolk, and 0.5 cup sugar until pale, ~2 minutes.

  6. 6

    Slowly pour the hot milk into the egg mixture while whisking constantly to temper.

  7. 7

    Stir in 1 tsp vanilla and 0.25 tsp salt. Strain through a fine-mesh sieve into a bowl.

  8. 8

    Drop spoonfuls of dulce de leche over the caramel base, then slowly pour custard over.

  9. 9

    Place the baking dish in a larger roasting pan. Fill the roasting pan with hot water halfway up the flan.

  10. 10

    Bake at 325°F for 40–45 minutes until the custard is set but jiggles slightly in the center.

  11. 11

    Cool completely, then refrigerate for at least 4 hours or overnight.

  12. 12

    Run a knife around the edges, then invert onto a shallow plate. The caramel should flow over the top.

  13. 13

    Serve chilled or at room temperature.

Tools you’ll need

  • 9-inch round baking dish
  • roasting pan
  • saucepan
  • whisk
  • mixing bowl
  • fine-mesh sieve
  • knife
  • shallow serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.