Custrd is out on the App Store — Download it free →
Back to recipes

25-Min Fish Sinigang with Crispy Fried Shallots

Tangy tamarind broth loaded with tender fish and vegetables, finished with crispy fried shallots for texture. Serve with fried spring rolls and a spicy vinegar dip for dipping.

Total time
25 min
Servings
2
Calories
285
Protein
28g
25-Min Fish Sinigang with Crispy Fried Shallots
comfortheartyfilipinofishtendercrispyweeknightdinner

Ingredients

  • 1 lb fish fillet (tilapia or grouper), cut into 2-inch chunks
  • 3 tbsp tamarind paste
  • 1 cup radish (daikon), sliced 1/4-inch thick
  • 2 cups leafy greens (bok choy or spinach), roughly chopped
  • 1 cup shallots, thinly sliced (divided: 1/2 cup for broth, 1/2 cup for frying)
  • 4 cups fish stock or water
  • 2 tbsp neutral oil for frying

Instructions

  1. 1

    Heat oil in a large pot over medium-high. Fry 1/2 cup sliced shallots until golden and crispy, 3–4 minutes. Transfer to a paper towel; set aside.

  2. 2

    In the same pot, bring stock and remaining shallots to a boil over high heat, 2 minutes.

  3. 3

    Stir tamarind paste into the broth until dissolved. Add radish slices and bring to a gentle simmer.

  4. 4

    Slide fish chunks into the broth. Cook at a gentle bubble until fish is opaque and flakes easily, 6–7 minutes.

  5. 5

    Stir in leafy greens and cook until just wilted, 1 minute. Taste and adjust salt and tamarind as needed.

  6. 6

    Pour into bowls, top with crispy fried shallots, and serve with fried spring rolls and spicy vinegar dip on the side.

Tools you’ll need

  • large heavy-bottomed pot (4–6 quart capacity)
  • slotted spoon
  • paper towels
  • spoon for stirring
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.