CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Minute Crispy Zucchini Parm

Thin-sliced zucchini, pan-fried until golden, layered with marinara and melty mozzarella. Ready in 20 minutes — the weeknight version of the Italian classic.

Total time
20 min
Servings
4
Calories
385
Protein
16g
20-Minute Crispy Zucchini Parm
comfortsatisfyingitalianvegetarianvegetariancrispymeltytender

Ingredients

  • 3 whole zucchini, medium
  • ½ cup all-purpose flour
  • 1.5 cups marinara sauce
  • 8 oz fresh mozzarella, low-moisture
  • ½ cup parmesan cheese, grated
  • ½ cup neutral cooking oil

Instructions

  1. 1

    Slice zucchini lengthwise into 1/4-inch-thick planks. Pat dry with paper towels.

  2. 2

    Pour flour into a shallow bowl. Dredge each zucchini slice lightly, shaking off excess.

  3. 3

    Heat oil in a large skillet over medium-high until it shimmers, ~60 seconds.

  4. 4

    Pan-fry zucchini in batches 2–3 minutes per side until golden brown. Transfer to a plate.

  5. 5

    Wipe skillet clean. Spread 1/2 cup marinara on the bottom. Layer half the zucchini, half the mozzarella, half the parmesan, then remaining sauce.

  6. 6

    Top with remaining zucchini, mozzarella, and parmesan. Cook over medium 3–4 minutes until cheese melts and edges bubble.

Tools you’ll need

  • chef's knife
  • cutting board
  • paper towels
  • shallow bowl
  • 12-inch skillet
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Italian recipes →