CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Taiwanese Chicken Cutlet with Slaw

Pounded chicken breast fried until golden and crunchy, served with a bright vinegary slaw and carrot. Ready in under 15 minutes — the kind of snack that feels way fancier than it is.

Total time
12 min
Servings
2
Calories
420
Protein
34g
Crispy Taiwanese Chicken Cutlet with Slaw
casualsatisfyingtaiwanesechickencrispytendercrunchySalad

Ingredients

  • 2 breasts (about 6 oz each) boneless, skinless chicken breasts
  • ½ cup all-purpose flour
  • 1 large egg
  • 2 medium carrots
  • 2 cups, shredded napa cabbage
  • 2 tbsp white vinegar

Instructions

  1. 1

    Pat chicken dry. Place each breast between plastic wrap and pound to 1/4-inch thickness.

  2. 2

    Season chicken generously with salt and pepper. Whisk egg in a shallow bowl; spread flour in another.

  3. 3

    Coat each cutlet in flour, shake off excess, dip in egg, then coat in flour again for extra crunch.

  4. 4

    Heat 3 tbsp oil in a 12-inch skillet over medium-high until shimmering. Fry cutlets 3 minutes per side until golden brown.

  5. 5

    Toss shredded cabbage and sliced carrots with vinegar, salt, and pepper in a bowl.

  6. 6

    Plate cutlets alongside the slaw. Serve immediately while chicken is still crackling.

Tools you’ll need

  • 12-inch skillet
  • plastic wrap
  • meat mallet
  • two shallow bowls
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.