CookSnap is coming soon — Join the waitlist →

Crispy Squash Blossom Quesadillas

Golden, melty flour tortillas stuffed with delicate squash blossoms and cheese, pan-fried until the exterior crisps. Ready in 10 minutes—pure comfort.

Total time
10 min
Servings
2
Calories
310
Protein
10g
Crispy Squash Blossom Quesadillas
satisfyingquickmexicanvegetariancrispymeltyweeknightsnack

Ingredients

  • 1.5 cups squash blossoms, stemmed and lightly packed
  • ¾ cup Mexican cheese blend or Oaxaca cheese
  • 4 tortillas flour tortillas, 8-inch
  • 2 tbsp butter
  • 1 pinch salt and pepper

Instructions

  1. 1

    Toss squash blossoms with a pinch of salt and pepper. Layer half a tortilla with a small handful of cheese, then a pinch of blossoms, then more cheese.

  2. 2

    Fold tortilla in half. Lay it flat on a plate. Repeat with remaining tortillas, cheese, and blossoms.

  3. 3

    Heat butter in a large skillet over medium-high until it foams, about 45 seconds.

  4. 4

    Sear first 2 quesadillas until the tortilla is golden brown and the cheese starts to peek out at the edges, 2–3 minutes per side.

  5. 5

    Transfer to a plate. Sear the remaining 2 quesadillas the same way, adding more butter if the pan looks dry.

  6. 6

    Serve hot, optionally with crema, salsa, or a squeeze of lime.

Tools you’ll need

  • 12-inch skillet
  • tongs
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.