CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Sole Meunière

Paper-thin sole fillets pan-seared until golden, then finished with brown butter and lemon. Elegant, fast, and pure French bistro on a weeknight.

Total time
15 min
Servings
2
Calories
310
Protein
32g
Crispy Sole Meunière
elegantlightfrenchfishcrispytenderflakyweeknight

Ingredients

  • 2 fillets sole fillets (or flounder), about 5 oz each
  • ⅓ cup all-purpose flour
  • 4 tbsp butter
  • 1 whole lemon
  • 2 tbsp fresh parsley, chopped
  • 0 to taste salt and black pepper to taste

Instructions

  1. 1

    Pat sole dry with paper towels. Season both sides generously with salt and pepper.

  2. 2

    Spread flour on a plate. Dredge each fillet lightly on both sides, shaking off excess.

  3. 3

    Heat 2 tbsp butter in a 12-inch skillet over medium-high until foaming, about 90 seconds.

  4. 4

    Lay sole in the pan without moving for 2 minutes until the underside is golden, then flip and cook 1 minute more.

  5. 5

    Transfer sole to a plate. Add remaining 2 tbsp butter to the skillet, swirling until it turns nutty brown, about 90 seconds.

  6. 6

    Squeeze half the lemon over the sole, drizzle with brown butter, and finish with parsley. Serve immediately.

Tools you’ll need

  • 12-inch stainless steel or non-stick skillet
  • paper towels
  • shallow plate
  • tongs or fish spatula
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.