CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Crispy Rye Toast with Whipped Butter

Scandinavian-style dark rye bread toasted until the edges crackle, finished with cultured butter whipped with salt and fresh dill. A simple, satisfying open-faced meal that tastes like bakery-quality bread deserves.

Total time
15 min
Servings
2
Calories
240
Protein
5g
15-Min Crispy Rye Toast with Whipped Butter
simplewholesomescandinavianvegetariancrispytenderweeknightbread

Ingredients

  • 4 slices dark rye bread (rugbrød or pumpernickel), sliced 0.5-inch thick
  • 3 tbsp unsalted butter, softened
  • 1 tbsp fresh dill, chopped
  • ¼ tsp fleur de sel or sea salt
  • 1 medium radish, thinly sliced
  • ½ whole lemon, cut into wedges

Instructions

  1. 1

    Whip softened butter with dill and fleur de sel until pale and fluffy, about 2 minutes.

  2. 2

    Heat a large skillet over medium-high until very hot, about 90 seconds.

  3. 3

    Toast rye slices without oil until edges darken and surface crisps, 2–3 minutes per side.

  4. 4

    Spread whipped butter generously on each warm toast slice while still hot.

  5. 5

    Top with radish slices and a squeeze of lemon juice.

  6. 6

    Serve immediately while the toast is still warm.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • whisk or fork
  • butter knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Scandinavian recipes →