CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Roasted Corn Ribs

Corn sliced lengthwise into "ribs," roasted until caramelized and crispy, then brushed with a spiced butter and lime. A vegetable-forward side that eats like a main.

Total time
35 min
Servings
4
Calories
168
Protein
3g
Crispy Roasted Corn Ribs
casualsimplevegetariancrispytenderweeknightsummerside

Ingredients

  • 4 whole corn ears, husked
  • 3 tbsp butter
  • 2 cloves garlic, minced
  • ¾ tsp chili powder
  • 1 whole lime (juiced)
  • ½ tsp salt
  • ¼ tsp black pepper

Instructions

  1. 1

    Preheat oven to 425°F. Line a large baking sheet with parchment paper.

  2. 2

    Stand each corn ear upright on a cutting board. Slice lengthwise into 3–4 pieces, following the natural seams.

  3. 3

    Arrange corn ribs cut-side up on the baking sheet. Drizzle lightly with olive oil, salt, and pepper.

  4. 4

    Roast for 15 minutes, shaking the pan halfway through, until edges are golden and caramelized.

  5. 5

    While corn cooks, melt butter in a small skillet over medium heat. Add garlic and chili powder, cook 60 seconds until fragrant.

  6. 6

    Remove from heat. Stir in lime juice, salt, and pepper.

  7. 7

    Remove corn from oven. Brush generously with the chili-lime butter on both sides.

  8. 8

    Return to oven for 3 more minutes until butter is absorbed and edges look crispy.

  9. 9

    Serve hot, with any remaining chili butter drizzled over the top.

Tools you’ll need

  • 9x13 baking sheet
  • parchment paper
  • sharp chef's knife
  • small skillet
  • cutting board
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.