CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Rice Paper Rolls with Peanut Dip

Shatteringly crispy fried rice paper wrapped around fresh herbs and vegetables, dunked in a punchy peanut-lime sauce. Total TikTok dinner—ready in 25 minutes, looks impossible, tastes like a Vietnamese street cart.

Total time
25 min
Servings
2
Calories
420
Protein
12g
Crispy Rice Paper Rolls with Peanut Dip
freshcasualvietnamesevegetariandairy-freevegetariancrispytender

Ingredients

  • 8 sheets rice paper sheets (bánh tráng nướng, or regular spring roll wrappers)
  • 2 cups packed fresh herbs (mint, cilantro, and Thai basil), leaves picked
  • 1 medium cucumber, sliced into thin matchsticks
  • 1 medium carrot, julienned
  • ¼ cup natural peanut butter
  • 1 lime + 2 tbsp sauce lime (juiced) + fish sauce
  • 2 cups neutral cooking oil for frying

Instructions

  1. 1

    Whisk peanut butter, lime juice, fish sauce, 2 tbsp water, and a pinch of sugar until smooth. Add more water if too thick.

  2. 2

    Heat oil in a heavy skillet over medium-high until a wooden chopstick dipped in sizzles immediately, ~3 minutes.

  3. 3

    Gently lay one rice paper sheet flat. Top with a small pinch each of herbs, cucumber, and carrot—don't overstuff.

  4. 4

    Roll the sheet tightly, folding in the sides like a burrito. Repeat with remaining sheets.

  5. 5

    Working in batches, slide rolls into hot oil and fry 60–90 seconds per side until they're golden brown and crackling.

  6. 6

    Drain on paper towels. Serve hot with peanut sauce on the side for dipping.

Tools you’ll need

  • small mixing bowl
  • whisk
  • heavy skillet or wok (12-inch preferred)
  • wooden chopstick or probe thermometer
  • paper towels
  • slotted spoon or spider skimmer

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →