CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Potato Pierogi with Caramelized Onions

Golden, crispy pan-fried potato-filled dumplings topped with sweet, jammy caramelized onions and sour cream. A weeknight shortcut using wonton wrappers instead of dough—ready in under 20 minutes.

Total time
18 min
Servings
4
Calories
412
Protein
11g
Crispy Potato Pierogi with Caramelized Onions
comfortcozypolishvegetarianvegetariancrispytenderweeknight

Ingredients

  • 2 large yellow onions, thinly sliced
  • 1.5 cups russet potatoes, cooked and mashed
  • ½ cup sharp cheddar, shredded
  • 24 count wonton wrappers
  • ½ cup sour cream
  • 3 tbsp neutral oil (for pan-frying)

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-low. Add onions with a pinch of salt and cook, stirring occasionally, until deep golden and jammy, about 12 minutes.

  2. 2

    While onions cook, mix mashed potatoes with cheddar and a pinch of salt and pepper in a bowl.

  3. 3

    Lay a wonton wrapper on the counter. Spoon 1 tbsp potato filling into the center. Wet the edges with water, fold into a triangle, then bring the two corners together. Repeat with remaining wrappers.

  4. 4

    Transfer caramelized onions to a plate. Add remaining 2 tbsp oil to the skillet over medium-high heat until shimmering.

  5. 5

    Working in batches, pan-fry pierogi 90 seconds per side until crispy and golden brown. Do not crowd the pan.

  6. 6

    Serve pierogi topped with caramelized onions and a dollop of sour cream.

Tools you’ll need

  • 12-inch skillet
  • mixing bowl
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.