CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pierogi with Caramelized Onions

Frozen pierogi crisped in a skillet with deeply golden caramelized onions, sour cream, and fresh dill. No dough-making required—just pan-fry and top.

Total time
20 min
Servings
4
Calories
385
Protein
11g
Crispy Pierogi with Caramelized Onions
comfortrusticpolishvegetarianvegetariancrispytenderweeknight

Ingredients

  • 1.5 lbs frozen potato and cheese pierogi
  • 3 medium yellow onions
  • ¾ cup sour cream
  • 2 tbsp, chopped fresh dill
  • 3 tbsp butter
  • ½ tsp smoked paprika

Instructions

  1. 1

    Slice onions into thin half-moons. Heat 1 tbsp butter in a large skillet over medium.

  2. 2

    Add onions with a pinch of salt. Cook, stirring often, until deep golden, ~10 minutes.

  3. 3

    Push onions to the side. Add remaining 2 tbsp butter, then slide in pierogi in a single layer.

  4. 4

    Sear pierogi without moving for 3 minutes per side until golden and crispy at edges.

  5. 5

    Toss pierogi with onions. Sprinkle paprika, then stir in dill and a pinch of black pepper.

  6. 6

    Transfer to a plate and serve hot with sour cream on the side or dolloped on top.

Tools you’ll need

  • 12-inch skillet
  • knife and cutting board
  • wooden spoon
  • serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.