CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Potato Pancakes with Honey & Jam

Golden, lacy-edged potato pancakes fried until impossibly crispy. Serve warm with honey, fruit jam, and a squeeze of fresh lemon — classic Polish comfort in under 20 minutes.

Total time
20 min
Servings
2
Calories
380
Protein
6g
Crispy Potato Pancakes with Honey & Jam
comfortrusticpolishvegetarianvegetariancrispytenderweeknight

Ingredients

  • 3 whole russet potatoes, medium
  • 3 tbsp all-purpose flour
  • 1 whole egg, beaten
  • ½ cup honey, for serving
  • ½ cup fruit jam, for serving
  • 1 whole lemon, for squeezing

Instructions

  1. 1

    Peel potatoes and grate them into a clean kitchen towel. Wring out as much liquid as possible over the sink.

  2. 2

    Transfer grated potato to a bowl. Stir in flour, egg, 1/2 tsp salt, and 1/4 tsp black pepper until combined.

  3. 3

    Heat 0.25 inch neutral oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  4. 4

    Drop 3 tbsp batter per pancake into the oil. Flatten slightly with a spatula and fry 3-4 minutes until bottom edges turn golden brown.

  5. 5

    Flip pancakes carefully. Fry the other side 2-3 minutes until golden and edges curl up. Transfer to a plate.

  6. 6

    Serve warm pancakes with honey, jam, a squeeze of lemon, and hot tea on the side.

Tools you’ll need

  • box grater or microplane
  • kitchen towel
  • medium bowl
  • 10-inch skillet
  • spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.