CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Potato Gratin

Thinly sliced potatoes layered with Gruyère and cream, then crisped under the broiler in one skillet. A French bistro classic that feels fancy but takes less than 25 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
18g
Crispy Potato Gratin
comfortelegantfrenchvegetariancheesecrispycreamytender

Ingredients

  • 4 medium potatoes, waxy or gold (about 1.5 lbs)
  • 1.5 cups Gruyère, grated
  • 1 cup heavy cream
  • ½ cup whole milk
  • 3 sprigs thyme, fresh
  • ¼ tsp nutmeg, ground
  • 1 tsp Dijon mustard
  • 1 medium shallot, minced

Instructions

  1. 1

    Heat broiler to high. Slice potatoes 1/8-inch thick (use a mandoline if you have one); don't peel.

  2. 2

    Whisk cream, milk, mustard, nutmeg, salt, and pepper in a bowl until combined. Stir in minced shallot.

  3. 3

    Spread 1 tbsp butter in a 12-inch cast-iron or oven-safe skillet. Layer half the potatoes, overlapping slightly.

  4. 4

    Scatter half the Gruyère over potatoes. Layer remaining potatoes, then remaining cheese. Pour cream mixture over top.

  5. 5

    Tuck thyme sprigs into the layers. Slide skillet under broiler 8–10 minutes until edges are deep golden and bubbling.

  6. 6

    Remove from broiler and rest 2 minutes. Top surface should be crispy and cheese should pull away from edges.

Tools you’ll need

  • 12-inch cast-iron or oven-safe skillet
  • mandoline or sharp knife
  • medium bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.