CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pork Lomitos

Thin-sliced pork shoulder seared until edges crisp, tossed with sautéed peppers and onions, finished with lime and oregano. A fast, savory weeknight dinner that tastes like street food.

Total time
15 min
Servings
4
Calories
420
Protein
42g
Crispy Pork Lomitos
quickcasualmexicanporkcrispytenderweeknightmain-dish

Ingredients

  • 1.5 lb pork shoulder, thinly sliced (about 1/4 inch)
  • 1 large bell pepper (red or green), sliced into thin strips
  • 1 medium yellow onion, sliced into thin strips
  • 1 whole lime (juiced)
  • 1 tsp dried oregano
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Work in two batches: sear pork slices 2–3 minutes per side until edges brown and crisp. Transfer to a plate.

  3. 3

    In the same skillet, sauté peppers and onions over medium-high, stirring occasionally, until soft and charred at edges, 4–5 minutes.

  4. 4

    Return pork to the skillet. Add oregano, lime juice, salt, and pepper. Toss to combine.

  5. 5

    Serve hot with warm tortillas, lime wedges, and fresh cilantro if desired.

Tools you’ll need

  • 12-inch skillet or larger
  • cutting board
  • sharp knife
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.