CookSnap is coming soon — Join the waitlist →

Crispy Pork Belly with Leeks & Chili Oil

Hui guo rou reimagined for weeknights: crispy pork belly seared until it shatters, tossed with tender leeks and a punchy soy-chili glaze. Ready in 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Crispy Pork Belly with Leeks & Chili Oil
satisfyingcasualchineseporkcrispytenderweeknightmain-dish

Ingredients

  • ¾ lb pork belly, skin-on
  • 3 medium leeks, white and light green parts
  • 3 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 2 tbsp chili oil or chili crisp
  • 3 cloves garlic, minced
  • 1 tbsp fresh ginger, minced

Instructions

  1. 1

    Cut pork belly into 1-inch cubes. Slice leeks into 1/2-inch rounds, rinse well.

  2. 2

    Heat a large skillet over medium-high. Add pork skin-side down; render fat until skin crisps, ~8 minutes. Flip and sear meat side until golden, ~3 minutes.

  3. 3

    Remove pork to a plate. Pour off all but 1 tbsp fat. Add leeks; sauté until soft and slightly charred, ~4 minutes.

  4. 4

    Add garlic and ginger; cook until fragrant, ~30 seconds. Stir in soy sauce, vinegar, and chili oil.

  5. 5

    Return pork to skillet. Toss everything together for 1 minute until coated and heated through.

  6. 6

    Serve immediately over steamed white rice or with a simple side of blanched bok choy.

Tools you’ll need

  • 12-inch cast iron or heavy skillet
  • cutting board
  • chef's knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.