CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Mung Bean Banh Pia

Flaky Vietnamese pastries filled with sweet mung bean paste, sesame, and a hint of coconut. Crispy outside, creamy inside—baked in 20 minutes and perfect warm or at room temperature.

Total time
25 min
Servings
4
Calories
320
Protein
6g
Crispy Mung Bean Banh Pia
casualwholesomevietnamesevegetariandairy-freevegetariancrispyflaky

Ingredients

  • 1 package (2 sheets) frozen puff pastry sheets
  • 1 can (14 oz) canned mung bean paste (sweetened)
  • 3 tbsp sesame seeds
  • 2 tbsp unsweetened shredded coconut
  • 1 tbsp vegetable oil (for brushing)
  • 1 whole egg
  • 1 tbsp water

Instructions

  1. 1

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  2. 2

    Thaw puff pastry sheets for 5 minutes. Mix mung bean paste, sesame seeds, and coconut in a bowl.

  3. 3

    Cut each pastry sheet into 4 squares. Place 2 tbsp filling in the center of each square.

  4. 4

    Fold each square into a triangle, then press and fold again into a small square. Press edges to seal.

  5. 5

    Whisk egg with water. Brush pastries with egg wash, then place on the baking sheet.

  6. 6

    Bake until golden brown and puffed, 12–15 minutes. Cool 2 minutes before serving.

Tools you’ll need

  • baking sheet
  • parchment paper
  • small mixing bowl
  • knife
  • small bowl (for egg wash)
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.