CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Banh Pia — Vietnamese Mung Bean Pastries

Flaky, buttery pastry pockets with a sweet mung bean and sesame filling. Hand-formed in under 25 minutes and finished golden in a skillet for that viral crackle.

Total time
25 min
Servings
4
Calories
385
Protein
7g
Crispy Banh Pia — Vietnamese Mung Bean Pastries
casualindulgentvietnamesevegetarianvegetariancrispyflakytender

Ingredients

  • 1.5 cups all-purpose flour
  • 6 tbsp butter, cold and cubed
  • 1 whole salted egg yolk (or sweet egg yolk)
  • ¾ cup mung bean paste (canned or homemade)
  • 3 tbsp sesame seeds
  • 2 tbsp sugar
  • ½ tsp vanilla extract
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Mix flour, butter, egg yolk, and a pinch of salt in a bowl with your fingers until the mixture looks like breadcrumbs. Add 2 tbsp cold water and press until a shaggy dough forms.

  2. 2

    Fold mung bean paste with sesame seeds, sugar, and vanilla. Divide into 8 portions and roll into balls.

  3. 3

    Pinch off 1 tbsp dough, flatten to a disk, place one filling ball in center, wrap dough around it, and seal by pressing and shaping into a 2-inch round disk.

  4. 4

    Heat oil in a 12-inch skillet over medium until shimmering. Pan-fry pastries 2 minutes per side until golden-brown edges curl slightly.

  5. 5

    Serve warm. The exterior should crackle when you bite; mung bean center stays creamy.

Tools you’ll need

  • medium mixing bowl
  • 12-inch non-stick or cast-iron skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.