CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Miso Butter Onigiri with Pickles

Pan-seared rice balls with a glossy miso-butter crust, served alongside tangy pickled cucumbers. Ready in 15 minutes — the ultimate weeknight bite.

Total time
15 min
Servings
2
Calories
285
Protein
5g
Crispy Miso Butter Onigiri with Pickles
quicksatisfyingjapanesevegetarianvegetariancrispytenderweeknight

Ingredients

  • 2 cups cooked short-grain white rice, cooled
  • 2 sheets nori (seaweed sheets), cut into 2-inch strips
  • 1.5 tbsp white miso paste
  • 1 tbsp butter
  • ½ tbsp soy sauce
  • ½ cup pickled cucumbers

Instructions

  1. 1

    Wet your hands lightly with water. Divide rice into 4 equal portions, then pack each into a tight ball.

  2. 2

    Wrap one nori strip around the base of each rice ball, pressing gently so it adheres.

  3. 3

    Mix miso, butter, and soy sauce in a small bowl until smooth and fully combined.

  4. 4

    Heat a skillet over medium-high heat. Place onigiri seam-side down and sear 2–3 minutes until the bottom turns deep golden brown.

  5. 5

    Brush the miso-butter mixture onto each onigiri's top and sides, then flip and sear 90 seconds more until glossy and caramelized.

  6. 6

    Serve hot alongside pickled cucumbers.

Tools you’ll need

  • small bowl
  • 12-inch skillet or larger

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.