Crispy Margherita Tortilla Pizza
Crispy-bottomed tortilla pizza with tangy marinara, melted fresh mozzarella, and bright basil—ready in 10 minutes. The kind of weeknight dinner that tastes way better than it should.
- Total time
- 10 min
- Servings
- 2
- Calories
- 385
- Protein
- 14g
quicksimpleitalianvegetariancrispymeltyweeknightpizza
Ingredients
- 2 pieces flour tortillas (8-inch)
- ½ cup marinara sauce
- 6 oz fresh mozzarella
- 8 leaves fresh basil leaves
Instructions
- 1
Heat a skillet over medium-high until oil shimmers, about 1 minute.
- 2
Lay a tortilla in the pan and let it crisp, about 90 seconds—you'll hear it sizzle.
- 3
Flip the tortilla, then spread 1/4 cup marinara and tear 3 oz mozzarella over the top.
- 4
Cover the pan with a lid or foil and cook until cheese melts, 1–2 minutes.
- 5
Slide onto a plate, scatter fresh basil on top, then repeat with the second tortilla.
Tools you’ll need
- 10-inch skillet with a lid or foil cover
- tongs or spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
