Crispy Margherita Tortilla
A thin-crust pizza made on a tortilla—tomato, fresh mozzarella, and basil baked until the edges crisp and cheese melts. Ready in under 10 minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 320
- Protein
- 12g
simplequickitalianvegetariancrispymeltyweeknightpizza
Ingredients
- 2 large (10-inch) flour tortilla
- 1 medium, sliced thin tomato
- 4 oz, torn into bite-size pieces fresh mozzarella cheese
- ¼ cup, leaves fresh basil
Instructions
- 1
Place tortillas on a baking sheet lined with foil.
- 2
Divide tomato slices between tortillas, leaving a 1/2-inch border.
- 3
Top each tortilla with half the mozzarella, spacing it evenly.
- 4
Bake at 425°F until cheese melts and edges turn golden brown.
- 5
Top with fresh basil leaves while still warm.
- 6
Slice and serve immediately.
Tools you’ll need
- baking sheet
- foil
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
