Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Crispy Lemon Dolmades

Tender grape leaves stuffed with herby rice and pan-fried until golden, finished with a bright lemon squeeze. A weeknight Greek dinner that tastes like you spent hours rolling by hand.

Total time
20 min
Servings
2
Calories
285
Protein
8g
20-Min Crispy Lemon Dolmades
freshlightgreekvegetarianveganvegetariantendercrispy

Ingredients

  • 1 jar (16 oz) jarred grape leaves in brine
  • 1.5 cups cooked rice (white or brown)
  • ¼ cup fresh dill, finely chopped
  • 2 tbsp fresh mint, finely chopped
  • 1 whole (zested + juiced) lemon
  • 3 tbsp olive oil
  • ¼ cup pine nuts or walnuts, roughly chopped
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Rinse grape leaves under cool water and gently separate them. Pat dry with paper towels.

  2. 2

    Stir cooked rice with dill, mint, lemon zest, pine nuts, salt, and pepper until well combined.

  3. 3

    Lay a grape leaf shiny-side down. Place 2 tbsp filling near the stem end, fold sides inward, then roll away from you into a tight cigar. Repeat with remaining leaves and filling.

  4. 4

    Heat olive oil in a large skillet over medium-high heat until shimmering, about 90 seconds.

  5. 5

    Working in batches, place dolmades seam-side down in the skillet. Don't crowd the pan. Sear 2–3 minutes per side until edges curl slightly and leaves turn olive-gold.

  6. 6

    Transfer dolmades to a serving plate. Squeeze fresh lemon juice over the top and finish with a light pinch of fleur de sel if you have it.

Tools you’ll need

  • paper towels
  • medium bowl
  • large 12-inch skillet
  • kitchen knife
  • microplane zester (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.