Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Eggplant & Spiced Chickpea Bowls

Roasted eggplant halves stuffed with warm, spiced chickpeas, topped with tahini drizzle and fresh herbs. Sheet-pan Middle Eastern comfort that tastes restaurant-quality in under 20 minutes.

Total time
18 min
Servings
2
Calories
285
Protein
10g
Crispy Eggplant & Spiced Chickpea Bowls
comfortwholesomemiddle-easternvegetarianveganchickpeascreamytender

Ingredients

  • 1 whole eggplant, medium
  • 1 can (15 oz) canned chickpeas, drained and rinsed
  • 3 tbsp tahini
  • 1 tsp each cumin and coriander (or Italian seasoning)
  • 1 whole lemon, halved
  • ¼ cup fresh parsley or mint, chopped

Instructions

  1. 1

    Halve the eggplant lengthwise. Score the flesh in a crosshatch pattern, then brush all sides with oil and salt.

  2. 2

    Roast eggplant cut-side down on a sheet pan at 425°F until flesh is tender and golden, about 12 minutes.

  3. 3

    While eggplant roasts, toss chickpeas with cumin, coriander, 1 tbsp oil, salt, and pepper until coated and fragrant.

  4. 4

    Flip eggplant halves cut-side up. Mound chickpea mixture into each cavity, pressing gently to pack.

  5. 5

    Roast 3 more minutes until chickpeas warm through and eggplant edges darken slightly.

  6. 6

    Drizzle tahini mixed with lemon juice over each half. Scatter fresh herbs and a pinch of salt on top. Serve hot.

Tools you’ll need

  • sheet pan
  • knife
  • brush
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.