CookSnap is coming soon — Join the waitlist →
Back to recipes

Roasted Chickpea Buddha Bowl

Crispy roasted chickpeas, fluffy quinoa, and roasted sweet potato tossed with a bright tahini-lemon dressing. Builds a satisfying, protein-packed bowl in under 25 minutes.

Total time
25 min
Servings
2
Calories
580
Protein
18g
Roasted Chickpea Buddha Bowl
healthywholesomemediterraneanvegetarianveganchickpeascrispyfluffy

Ingredients

  • 1 can (15 oz) canned chickpeas, drained and dried
  • 1 large sweet potato, cut into 3/4-inch cubes
  • ¾ cup quinoa
  • 3 tbsp tahini
  • 1 whole lemon, juiced
  • 1 whole garlic clove, minced

Instructions

  1. 1

    Heat oven to 425°F. Toss chickpeas and sweet potato with 2 tbsp olive oil, salt, and pepper on a sheet pan.

  2. 2

    Roast for 18–20 minutes, shaking halfway, until sweet potato is tender and chickpeas are crispy.

  3. 3

    While vegetables roast, boil quinoa in salted water for 12–14 minutes until fluffy and liquid is absorbed.

  4. 4

    Whisk tahini, lemon juice, garlic, 3 tbsp water, salt, and pepper until smooth and pourable.

  5. 5

    Divide quinoa between two bowls. Top with roasted chickpeas and sweet potato.

  6. 6

    Drizzle tahini dressing over the top. Serve immediately.

Tools you’ll need

  • sheet pan
  • large pot with lid
  • small bowl
  • whisk
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.