CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Chicken Crostini

Toasted bread topped with shredded rotisserie chicken, garlic mayo, and fresh herbs—a Tuscan-style appetizer that feels fancy but takes 15 minutes. Serve as a weeknight dinner with a side salad or make a batch for snacking.

Total time
15 min
Servings
4
Calories
385
Protein
22g
Crispy Chicken Crostini
casualfreshitalianchickencrispytenderweeknightappetizer

Ingredients

  • ½ loaf baguette
  • 1.5 cups rotisserie chicken, shredded
  • ⅓ cup mayonnaise
  • 1 whole lemon (juiced)
  • ¼ cup fresh parsley, chopped
  • ¼ tsp red pepper flakes

Instructions

  1. 1

    Slice baguette diagonally into 0.5-inch-thick pieces. Arrange on a large skillet over medium heat.

  2. 2

    Toast bread 90 seconds per side until golden brown and both sides look crispy.

  3. 3

    Stir mayo, lemon juice, half the parsley, and red pepper flakes together in a bowl.

  4. 4

    Fold shredded chicken into the mayo mixture until evenly coated.

  5. 5

    Spoon chicken mixture generously onto each toasted slice.

  6. 6

    Sprinkle remaining parsley on top and serve immediately while bread is still warm.

Tools you’ll need

  • large skillet
  • cutting board
  • serrated knife
  • small mixing bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.