Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Arepas with Avocado & Cheese

Golden, fried corn cakes stuffed with creamy avocado and melty cheese. These Venezuelan-Colombian classics are crispy outside, soft inside, and ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
8g
Crispy Arepas with Avocado & Cheese
satisfyingcasualcolombianvegetariancheesecrispycreamyweeknight

Ingredients

  • 1.5 cups pre-cooked arepa flour (masarepa)
  • 1.5 cups warm water
  • 1 whole avocado, ripe
  • ½ cup white cheese (queso fresco or mozzarella)
  • ½ cup neutral cooking oil
  • ½ tsp salt and black pepper

Instructions

  1. 1

    Mix arepa flour with warm water and salt until a smooth, thick dough forms. Let rest 3 minutes.

  2. 2

    Mash avocado in a small bowl with a pinch of salt and black pepper.

  3. 3

    Divide dough into 4 equal balls. Flatten each into a disc, add a spoonful of avocado and cheese to the center, then seal and reshape into a flat cake.

  4. 4

    Heat oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  5. 5

    Slide arepas into hot oil and fry 3–4 minutes per side until deep golden brown and crispy.

  6. 6

    Transfer to a plate lined with paper towels. Serve hot.

Tools you’ll need

  • 10-inch skillet
  • small bowl
  • measuring cups
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.