CookSnap is coming soon — Join the waitlist →

Creamy Pumpkin Soup with Garlic Bread

Silky roasted pumpkin soup finished with cream and a hint of nutmeg, served with crispy garlic bread. Ready in 25 minutes with a sheet-pan approach.

Total time
25 min
Servings
4
Calories
340
Protein
6g
Creamy Pumpkin Soup with Garlic Bread
comfortwholesomefrenchvegetariancreamysilkyweeknightcozy

Ingredients

  • 2 cups pumpkin puree (or fresh pumpkin, roasted and mashed)
  • 3 cups vegetable broth
  • ½ cup heavy cream
  • 1 piece (8–10 inches) baguette or ciabatta
  • 4 tbsp butter, divided
  • 4 cloves garlic cloves, minced
  • ¼ tsp ground nutmeg

Instructions

  1. 1

    Slice the baguette lengthwise, then cut into 2-inch pieces.

  2. 2

    Melt 2 tbsp butter with minced garlic in a small bowl, stirring until fragrant, ~30 seconds.

  3. 3

    Brush garlic butter on the cut sides of bread. Arrange on a sheet pan, cut-side up.

  4. 4

    Toast bread in a 400°F oven until golden and crispy, ~8–10 minutes.

  5. 5

    While bread toasts, combine pumpkin puree, broth, and remaining 2 tbsp butter in a large pot over medium heat.

  6. 6

    Stir in cream and nutmeg, then simmer for 3 minutes. Season with salt and pepper to taste.

  7. 7

    Serve soup in bowls with garlic bread alongside.

Tools you’ll need

  • large pot
  • sheet pan
  • small mixing bowl
  • basting brush
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.