CookSnap is coming soon — Join the waitlist →

Creamy Garlic Shrimp Fettuccine

Succulent shrimp in a luxurious cream sauce tossed with tender fettuccine. A restaurant-quality Italian dish ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
645
Protein
38g
Creamy Garlic Shrimp Fettuccine
italianshrimppastacreamyweeknight-dinnergourmet

Ingredients

  • 8 oz fettuccine pasta
  • 12 oz large shrimp, peeled and deveined
  • 3 tbsp unsalted butter
  • 4 cloves garlic, minced
  • 1 cup heavy cream
  • ½ cup grated Parmesan cheese
  • ¼ cup dry white wine
  • 1 tbsp fresh lemon juice
  • 1 pinch salt and black pepper
  • 2 tbsp fresh parsley, chopped
  • ¼ tsp red pepper flakes

Instructions

  1. 1

    Bring a large pot of salted water to a rolling boil over high heat. Add the fettuccine and cook for 8-10 minutes, stirring occasionally, until al dente (tender but still slightly firm). Reserve 1 cup of pasta water before draining.

  2. 2

    While the pasta cooks, pat the shrimp dry with paper towels and season with salt and pepper on both sides. This helps them sear properly and develop a golden crust.

  3. 3

    Melt 1 tablespoon of butter in a large skillet over medium-high heat until foaming. Add the shrimp in a single layer and sear for 2-3 minutes per side until they turn opaque pink and register 145°F internally. Transfer to a plate.

  4. 4

    In the same skillet, melt the remaining 2 tablespoons of butter over medium heat. Add the minced garlic and sauté for 30 seconds until fragrant, stirring constantly to prevent browning.

  5. 5

    Pour in the white wine and simmer for 2-3 minutes, scraping up any browned bits from the bottom with a wooden spoon. The liquid should reduce by about half and smell rich and aromatic.

  6. 6

    Reduce heat to medium and stir in the heavy cream, bringing it to a gentle simmer. Cook for 2-3 minutes, stirring occasionally, until the sauce thickens enough to coat the back of a spoon lightly.

  7. 7

    Stir in the Parmesan cheese and lemon juice until the cheese melts and the sauce is smooth, about 1 minute. Add the cooked shrimp back to the skillet along with a pinch of red pepper flakes.

  8. 8

    Add the cooked fettuccine directly to the sauce and toss gently for 1-2 minutes, adding reserved pasta water a splash at a time until the sauce coats the noodles silkily. The pasta should glisten and move easily in the pan.

  9. 9

    Divide the fettuccine between two bowls or plates and garnish with fresh parsley and extra Parmesan. Serve immediately while the sauce is hot and creamy.

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.