CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Crawfish Mac & Cheese

Creamy, buttery crawfish mac finished with a Cajun kick — cooked in one skillet in under 15 minutes. Serve with the green salad and potato salad from your plate for a complete Cajun dinner.

Total time
20 min
Servings
4
Calories
642
Protein
48g
20-Min Crawfish Mac & Cheese
comfortindulgentcajunshrimpcreamytenderweeknightdinner

Ingredients

  • 8 oz elbow pasta
  • 1 lb crawfish tail meat (fresh or thawed frozen)
  • 1.5 cups sharp cheddar cheese, shredded
  • 3 tbsp butter
  • ¾ cup heavy cream
  • 2 tsp Cajun seasoning
  • 1 whole lemon (halved)
  • 3 tbsp scallions, chopped

Instructions

  1. 1

    Boil pasta in salted water until al dente, about 8 minutes. Reserve 1 cup pasta water before draining.

  2. 2

    While pasta cooks, melt butter in a large skillet over medium heat. Add crawfish and Cajun seasoning, stirring gently for 2 minutes until fragrant.

  3. 3

    Pour in cream and bring to a bare simmer. Add shredded cheddar in handfuls, stirring until melted and smooth, about 3 minutes.

  4. 4

    Stir in drained pasta and 0.5 cup pasta water. Cook 2 minutes until sauce coats every piece; add more pasta water if too thick.

  5. 5

    Squeeze lemon over the top. Taste and adjust seasoning with salt and pepper.

  6. 6

    Serve hot, garnished with chopped scallions. Serve with the green salad and potato salad on the side.

Tools you’ll need

  • large pot (for pasta)
  • large skillet (12-inch)
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Cajun recipes →