CookSnap is coming soon — Join the waitlist →
Back to recipes

Com Ga Xoi Mo (Vietnamese Chicken Rice)

Silky chicken poached in aromatics, shredded and served over fragrant rice with a ginger-scallion oil. A Vietnamese comfort classic that's light yet deeply satisfying.

Total time
45 min
Servings
4
Calories
595
Protein
42g
Com Ga Xoi Mo (Vietnamese Chicken Rice)
comfortwholesomevietnamesechickentendersilkyweeknightcomfort-food-night

Ingredients

  • 1.5 lb boneless, skinless chicken breasts
  • 2 cups jasmine or white rice
  • 3 oz ginger, divided
  • 6 pieces scallions, divided
  • 3 tbsp fish sauce
  • ⅓ cup olive oil
  • 1 portion salt and pepper to taste

Instructions

  1. 1

    Bring 8 cups water to a boil in a large pot. Add chicken, half the ginger (smashed), 3 scallions (whole), and 1 tbsp fish sauce.

  2. 2

    Reduce heat and simmer 12–15 minutes until chicken is cooked through. Remove chicken and set aside; strain broth into a measuring cup.

  3. 3

    Measure 4 cups broth back into the pot. Bring to a boil and stir in rice. Reduce heat, cover, and cook 18 minutes until tender.

  4. 4

    Shred the cooled chicken into bite-sized pieces with two forks.

  5. 5

    Mince remaining ginger and remaining 3 scallions. Heat oil in a small skillet over medium until shimmering, ~2 minutes.

  6. 6

    Add ginger and scallions; cook 1 minute until fragrant. Remove from heat and stir in remaining 2 tbsp fish sauce.

  7. 7

    Fluff rice with a fork. Divide rice among bowls and top with shredded chicken.

  8. 8

    Drizzle ginger-scallion oil over each bowl. Season with salt and pepper to taste. Serve immediately.

Tools you’ll need

  • large pot with lid (6+ quart)
  • small skillet
  • measuring cups and spoons
  • two forks (for shredding)
  • spoon or ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.