CookSnap is coming soon — Join the waitlist →
Back to recipes

Com Chien (Vietnamese Fried Rice)

A vibrant Vietnamese fried rice loaded with shrimp, chicken, and eggs, finished with fish sauce and fresh herbs. Ready in under 30 minutes with day-old rice.

Total time
25 min
Servings
4
Calories
385
Protein
28g
Com Chien (Vietnamese Fried Rice)
quicksatisfyingvietnameseshrimpchickeneggsfluffytender

Ingredients

  • 3 cups Cooked jasmine rice (day-old, chilled)
  • ½ lb Large shrimp, peeled and deveined
  • ¾ cup Cooked chicken, diced
  • 3 whole Eggs
  • 3 cloves Garlic, minced
  • 3 tbsp Fish sauce (nam pla)
  • 3 tbsp Vegetable oil
  • 1 cup Frozen peas and carrots
  • ½ cup Green onions and fresh cilantro (chopped)

Instructions

  1. 1

    Heat 1 tbsp oil in a 14-inch wok or large skillet over high heat until it shimmers, ~90 seconds.

  2. 2

    Add shrimp and cook without stirring for 90 seconds, then flip and cook 90 seconds more until pink.

  3. 3

    Transfer shrimp to a plate. Add remaining 2 tbsp oil to the wok.

  4. 4

    Pour in beaten eggs, stirring constantly until large curds form, ~2 minutes. Transfer to the plate with shrimp.

  5. 5

    Add garlic and stir-fry for 30 seconds until fragrant, then add peas, carrots, and diced chicken.

  6. 6

    Add chilled rice, breaking up any clumps with a wooden spoon. Toss constantly for 2–3 minutes.

  7. 7

    Pour fish sauce over rice and toss for 1 minute until the color is even and aromatic.

  8. 8

    Return shrimp and eggs to the wok. Toss gently to combine, ~30 seconds.

  9. 9

    Divide among bowls and top with green onions and cilantro. Serve hot.

Tools you’ll need

  • 14-inch wok or large skillet
  • wooden spoon or wok turner
  • cutting board
  • chef's knife
  • small bowl
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.