CookSnap is coming soon — Join the waitlist →

20-Min Coconut Seafood Stew

A streamlined Brazilian moqueca with shrimp, white fish, and bell peppers in a silky coconut-tomato broth. Bright, warm, and on the table in under 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
35g
20-Min Coconut Seafood Stew
comfortlightbrazilianshrimpfishtendersilkyweeknight

Ingredients

  • ½ lb large shrimp, peeled and deveined
  • ¾ lb white fish fillets (cod or halibut), cut into 2-inch chunks
  • 1 whole red bell pepper, sliced into 1/2-inch strips
  • 14 oz canned diced tomatoes
  • 13.5 oz coconut milk (full-fat)
  • 1 whole lime (juiced)
  • ¼ cup cilantro, chopped

Instructions

  1. 1

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add bell pepper and sliced yellow onion, cook 3 minutes, stirring occasionally, until edges soften.

  3. 3

    Pour in tomatoes and coconut milk, add 2 minced garlic cloves and 1/2 tsp salt. Bring to a gentle simmer.

  4. 4

    Slide fish chunks into the broth and cook 3 minutes without stirring. Add shrimp and cook until pink and opaque throughout, ~2 minutes.

  5. 5

    Squeeze lime juice over the top. Taste and adjust salt as needed. Stir in cilantro.

  6. 6

    Ladle into shallow bowls and serve hot with crusty bread or white rice on the side.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • cutting board
  • chef's knife
  • ladle
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.