CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Greek Fisherman's Broth

Kakavia is a rustic Greek seafood soup built on tomato broth with white fish and shrimp. This weeknight version skips the long simmer — just a bright, briny bowl ready in 20 minutes.

Total time
20 min
Servings
4
Calories
220
Protein
32g
20-Min Greek Fisherman's Broth
comfortlightgreekmediterraneanfishshrimptendersilky

Ingredients

  • 1 lb white fish fillets (cod, halibut, or sea bass)
  • ½ lb large shrimp, peeled and deveined
  • 1 can (14 oz) canned crushed tomatoes
  • 4 cups fish or seafood stock
  • 1 whole lemon (zested + juiced)
  • ½ cup Kalamata olives, halved
  • 2 tbsp fresh oregano or parsley (chopped)

Instructions

  1. 1

    Bring stock to a boil in a large pot over medium-high heat.

  2. 2

    Add tomatoes, lemon zest, salt, and pepper. Simmer 5 minutes until flavors meld.

  3. 3

    Cut fish into 2-inch chunks. Add to pot and simmer 4 minutes without stirring.

  4. 4

    Add shrimp and olives. Simmer until shrimp turns opaque and fish flakes easily, 3 minutes.

  5. 5

    Squeeze lemon juice into pot. Taste and season with salt and pepper.

  6. 6

    Ladle into bowls. Garnish with fresh oregano or parsley. Serve hot.

Tools you’ll need

  • large pot (6+ quart capacity)
  • cutting board
  • chef's knife
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.