CookSnap is coming soon — Join the waitlist →

Classic Reuben Sandwich

Crispy rye bread layered with corned beef, melted Swiss cheese, tangy sauerkraut, and creamy Russian dressing. A deli-style favorite that takes just 10 minutes to make.

Total time
10 min
Servings
2
Calories
512
Protein
28g
Classic Reuben Sandwich
comfortcasualamericanbeefcrispycreamytenderweeknight

Ingredients

  • ½ lb corned beef, sliced thin
  • 4 slices Swiss cheese
  • ¾ cup sauerkraut, drained
  • ¼ cup Russian dressing
  • 4 slices rye bread
  • 1.5 tbsp butter, softened

Instructions

  1. 1

    Spread 0.5 tbsp butter on one side of each bread slice. Spread Russian dressing on the other side of each slice.

  2. 2

    On two bread slices (dressing-side up), layer half the corned beef, then 1 cheese slice, then half the sauerkraut.

  3. 3

    Top each with the remaining two bread slices, butter-side up. Press down gently.

  4. 4

    Heat a skillet over medium-high. Slide one sandwich in and cook 3–4 minutes until golden brown and crispy.

  5. 5

    Flip and cook the other side 3–4 minutes until bread is golden and cheese melts completely.

  6. 6

    Repeat with the second sandwich. Serve hot.

Tools you’ll need

  • butter knife
  • cutting board
  • 12-inch skillet

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.